PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca3755.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 349aa    MW: 38261.5 Da    PI: 5.301
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca3755.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA633.4e-20266299134
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                C++C++tkTp+WR gp+g+ktLCnaCG+++++ +
  Dca3755.1 266 CTHCQVTKTPQWRAGPNGPKTLCNACGVRFKSGR 299
                *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.5E-741347IPR016679Transcription factor, GATA, plant
SMARTSM004016.6E-16260314IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.873260296IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.47E-14263323No hitNo description
Gene3DG3DSA:3.30.50.103.3E-15264297IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.29E-15265322No hitNo description
PROSITE patternPS003440266291IPR000679Zinc finger, GATA-type
PfamPF003207.1E-18266299IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MECMEAKALK SSFSSEIAVK SANPGGGNLD DIWCVSGGGV DDFSIDEFFD LPNEEDDVVF  60
DGHKDGVSSF EEEEEEEEEE EEEEKDSNCS GSISSSHEPV HDSAHFSTHL GIPDDDMQEL  120
ELWSHFMDDS VPEPNIACPK PTMVTHNAKT GFGFVNRAEP YSKPVNLVRV SYFPTAVPVK  180
PRSKRSRTVV NRSWFSGSPP KTESSSSSSS PSSPVSTLLY SPPAYEMGVF FAYGKPPAKK  240
PKKKPALPTS GACGDTGLNP AVQRRCTHCQ VTKTPQWRAG PNGPKTLCNA CGVRFKSGRL  300
FPEYRPACSP TFSSEVHSNS HRKVLEMRRR KEMTEPFPVN GSVNPLSSN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690771.11e-106PREDICTED: GATA transcription factor 7-like
TrEMBLA0A0K9QTQ31e-115A0A0K9QTQ3_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.18e-39GATA transcription factor 9